Torsin A (TOR1A) (NM_000113) Human Mass Spec Standard

CAT#: PH300389

TOR1A MS Standard C13 and N15-labeled recombinant protein (NP_000104)

Product Images

Coomassie blue staining of purified TOR1A protein (Cat# TP300389). The protein was produced from HEK293T cells transfected with TOR1A cDNA clone (Cat# RC200389) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200389
• Predicted MW: 37.8 kDa
• Protein Sequence:
  Sequence Link

  >RC200389 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKLGRAVLGLLLLAPSVVQAVEPISLGLALAGVLTGYIYPRLYCLFAECCGQKRSLSREALQKDLDDNLF
  GQHLAKKIILNAVFGFINNPKPKKPLTLSLHGWTGTGKNFVSKIIAENIYEGGLNSDYVHLFVATLHFPH
  ASNITLYKDQLQLWIRGNVSACARSIFIFDEMDKMHAGLIDAIKPFLDYYDLVDGVSYQKAMFIFLSNAG
  AERITDVALDFWRSGKQREDIKLKDIEHALSVSVFNNKNSGFWHSSLIHRNLIDYFVPFLPLEYKHLKMC
  IRVEMQSRGYEIDEDIVSRVAEEMTFFPKEERVFSDKGCKTVFTKLDYYYDD
  
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000104
• RefSeq Size: 2117
• RefSeq ORF: 996
• Synonyms: AMC5; DQ2; DYT1
• Locus ID: 1861
• UniProt ID: O14656, B3KPA1
• Cytogenetics: 9q34.11
• Summary: 'The protein encoded by this gene is a member of the AAA family of adenosine triphosphatases (ATPases), is related to the Clp protease/heat shock family and is expressed prominently in the substantia nigra pars compacta. Mutations in this gene result in the autosomal dominant disorder, torsion dystonia 1. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Protease