Torsin A (TOR1A) (NM_000113) Human Recombinant Protein

CAT#: TP300389

Recombinant protein of human torsin family 1, member A (torsin A) (TOR1A)

Product Images

Coomassie blue staining of purified TOR1A protein (Cat# TP300389). The protein was produced from HEK293T cells transfected with TOR1A cDNA clone (Cat# RC200389) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200389 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKLGRAVLGLLLLAPSVVQAVEPISLGLALAGVLTGYIYPRLYCLFAECCGQKRSLSREALQKDLDDNLF
  GQHLAKKIILNAVFGFINNPKPKKPLTLSLHGWTGTGKNFVSKIIAENIYEGGLNSDYVHLFVATLHFPH
  ASNITLYKDQLQLWIRGNVSACARSIFIFDEMDKMHAGLIDAIKPFLDYYDLVDGVSYQKAMFIFLSNAG
  AERITDVALDFWRSGKQREDIKLKDIEHALSVSVFNNKNSGFWHSSLIHRNLIDYFVPFLPLEYKHLKMC
  IRVEMQSRGYEIDEDIVSRVAEEMTFFPKEERVFSDKGCKTVFTKLDYYYDD
  
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Tag: C-Myc/DDK
• Predicted MW: 37.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_000104
• Locus ID: 1861
• UniProt ID: O14656, B3KPA1
• Cytogenetics: 9q34.11
• Refseq Size: 2117
• Refseq ORF: 996
• Synonyms: AMC5; DQ2; DYT1
• Summary: The protein encoded by this gene is a member of the AAA family of adenosine triphosphatases (ATPases), is related to the Clp protease/heat shock family and is expressed prominently in the substantia nigra pars compacta. Mutations in this gene result in the autosomal dominant disorder, torsion dystonia 1. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Protease