SNRPF (NM_003095) Human Mass Spec Standard
CAT#: PH300416
SNRPF MS Standard C13 and N15-labeled recombinant protein (NP_003086)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200416 |
Predicted MW | 9.7 kDa |
Protein Sequence |
>RC200416 protein sequence
Red=Cloning site Green=Tags(s) MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVL YIRGVEEEEEDGEMRE myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_003086 |
RefSeq Size | 806 |
RefSeq ORF | 258 |
Synonyms | Sm-F; SMF; snRNP-F |
Locus ID | 6636 |
UniProt ID | P62306 |
Cytogenetics | 12q23.1 |
Summary | '' |
Protein Families | Stem cell - Pluripotency |
Protein Pathways | Spliceosome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418906 | SNRPF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY418906 | Transient overexpression lysate of small nuclear ribonucleoprotein polypeptide F (SNRPF) |
USD 396.00 |
|
TP300416 | Recombinant protein of human small nuclear ribonucleoprotein polypeptide F (SNRPF) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review