SNRPF (NM_003095) Human Mass Spec Standard

CAT#: PH300416

SNRPF MS Standard C13 and N15-labeled recombinant protein (NP_003086)

Product Images

Coomassie blue staining of purified SNRPF protein (Cat# TP300416). The protein was produced from HEK293T cells transfected with SNRPF cDNA clone (Cat# RC200416) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200416
• Predicted MW: 9.7 kDa
• Protein Sequence:
  Sequence Link

  >RC200416 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVL
  YIRGVEEEEEDGEMRE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003086
• RefSeq Size: 806
• RefSeq ORF: 258
• Synonyms: Sm-F; SMF; snRNP-F
• Locus ID: 6636
• UniProt ID: P62306
• Cytogenetics: 12q23.1
• Summary: ''
• Protein Families: Stem cell - Pluripotency
• Protein Pathways: Spliceosome