Recoverin (RCVRN) (NM_002903) Human Mass Spec Standard

CAT#: PH300428

RCVRN MS Standard C13 and N15-labeled recombinant protein (NP_002894)

Product Images

Coomassie blue staining of purified RCVRN protein (Cat# TP300428). The protein was produced from HEK293T cells transfected with RCVRN cDNA clone (Cat# RC200428) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200428
• Predicted MW: 23.1 kDa
• Protein Sequence:
  Sequence Link

  >RC200428 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVF
  RSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKL
  LPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002894
• RefSeq Size: 1217
• RefSeq ORF: 600
• Synonyms: RCV1
• Locus ID: 5957
• UniProt ID: P35243
• Cytogenetics: 17p13.1
• Summary: 'This gene encodes a member of the recoverin family of neuronal calcium sensors. The encoded protein contains three calcium-binding EF-hand domains and may prolong the termination of the phototransduction cascade in the retina by blocking the phosphorylation of photo-activated rhodopsin. Recoverin may be the antigen responsible for cancer-associated retinopathy. [provided by RefSeq, Jul 2008]'