Rab2 (RAB2A) (NM_002865) Human Mass Spec Standard

CAT#: PH300433

RAB2A MS Standard C13 and N15-labeled recombinant protein (NP_002856)

Product Images

Coomassie blue staining of purified RAB2A protein (Cat# TP300433). The protein was produced from HEK293T cells transfected with RAB2A cDNA clone (Cat# RC200433) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200433
• Predicted MW: 23.5 kDa
• Protein Sequence:
  Sequence Link

  >RC200433 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQESFRS
  ITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESRREVKKEEGEAFARE
  HGLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINNEANGIKIGPQHAATNATHAGNQGGQQAGGG
  CC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002856
• RefSeq Size: 3812
• RefSeq ORF: 636
• Synonyms: LHX; RAB2
• Locus ID: 5862
• UniProt ID: P61019, A0A024R7V6
• Cytogenetics: 8q12.1-q12.2
• Summary: 'The protein encoded by this gene belongs to the Rab family, members of which are small molecular weight guanosine triphosphatases (GTPases) that contain highly conserved domains involved in GTP binding and hydrolysis. The Rabs are membrane-bound proteins, involved in vesicular fusion and trafficking. This protein is a resident of pre-Golgi intermediates, and is required for protein transport from the endoplasmic reticulum (ER) to the Golgi complex. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]'
• Protein Families: Druggable Genome