Rab2 (RAB2A) (NM_002865) Human Recombinant Protein

CAT#: TP300433

Recombinant protein of human RAB2A, member RAS oncogene family (RAB2A)

Product Images

Coomassie blue staining of purified RAB2A protein (Cat# TP300433). The protein was produced from HEK293T cells transfected with RAB2A cDNA clone (Cat# RC200433) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200433 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQESFRS
  ITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESRREVKKEEGEAFARE
  HGLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINNEANGIKIGPQHAATNATHAGNQGGQQAGGG
  CC
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 23.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002856
• Locus ID: 5862
• UniProt ID: P61019, A0A024R7V6
• Cytogenetics: 8q12.1-q12.2
• Refseq Size: 3812
• Refseq ORF: 636
• Synonyms: LHX; RAB2
• Summary: The protein encoded by this gene belongs to the Rab family, members of which are small molecular weight guanosine triphosphatases (GTPases) that contain highly conserved domains involved in GTP binding and hydrolysis. The Rabs are membrane-bound proteins, involved in vesicular fusion and trafficking. This protein is a resident of pre-Golgi intermediates, and is required for protein transport from the endoplasmic reticulum (ER) to the Golgi complex. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]
• Protein Families: Druggable Genome