PTP4A1 (NM_003463) Human Mass Spec Standard

CAT#: PH300435

PTP4A1 MS Standard C13 and N15-labeled recombinant protein (NP_003454)

Product Images

Coomassie blue staining of purified PTP4A1 protein (Cat# TP300435). The protein was produced from HEK293T cells transfected with PTP4A1 cDNA clone (Cat# RC200435) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200435
• Predicted MW: 19.8 kDa
• Protein Sequence:
  Sequence Link

  >RC200435 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPF
  DDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGA
  FNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003454
• RefSeq Size: 5093
• RefSeq ORF: 519
• Synonyms: HH72; PRL-1; PRL1; PTP(CAAX1); PTPCAAX1
• Locus ID: 7803
• UniProt ID: Q93096, A0A024R8J2
• Cytogenetics: 6q12
• Summary: This gene encodes a member of a small class of prenylated protein tyrosine phosphatases (PTPs), which contain a PTP domain and a characteristic C-terminal prenylation motif. The encoded protein is a cell signaling molecule that plays regulatory roles in a variety of cellular processes, including cell proliferation and migration. The protein may also be involved in cancer development and metastasis. This tyrosine phosphatase is a nuclear protein, but may associate with plasma membrane by means of its prenylation motif. Pseudogenes related to this gene are located on chromosomes 1, 2, 5, 7, 11 and X. [provided by RefSeq, Jun 2013]
• Protein Families: Druggable Genome, Phosphatase