PTP4A1 (NM_003463) Human Recombinant Protein
CAT#: TP300435
Recombinant protein of human protein tyrosine phosphatase type IVA, member 1 (PTP4A1)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200435 protein sequence
Red=Cloning site Green=Tags(s) MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPF DDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGA FNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 19.6 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003454 |
Locus ID | 7803 |
UniProt ID | Q93096, A0A024R8J2 |
Cytogenetics | 6q12 |
Refseq Size | 5093 |
Refseq ORF | 519 |
Synonyms | HH72; PRL-1; PRL1; PTP(CAAX1); PTPCAAX1 |
Summary | This gene encodes a member of a small class of prenylated protein tyrosine phosphatases (PTPs), which contain a PTP domain and a characteristic C-terminal prenylation motif. The encoded protein is a cell signaling molecule that plays regulatory roles in a variety of cellular processes, including cell proliferation and migration. The protein may also be involved in cancer development and metastasis. This tyrosine phosphatase is a nuclear protein, but may associate with plasma membrane by means of its prenylation motif. Pseudogenes related to this gene are located on chromosomes 1, 2, 5, 7, 11 and X. [provided by RefSeq, Jun 2013] |
Protein Families | Druggable Genome, Phosphatase |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418665 | PTP4A1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY418665 | Transient overexpression lysate of protein tyrosine phosphatase type IVA, member 1 (PTP4A1) |
USD 396.00 |
|
PH300435 | PTP4A1 MS Standard C13 and N15-labeled recombinant protein (NP_003454) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review