HPRT (HPRT1) (NM_000194) Human Mass Spec Standard

CAT#: PH300462

HPRT1 MS Standard C13 and N15-labeled recombinant protein (NP_000185)

Product Images

Coomassie blue staining of purified HPRT1 protein (Cat# TP300462). The protein was produced from HEK293T cells transfected with HPRT1 cDNA clone (Cat# RC200462) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200462
• Predicted MW: 24.6 kDa
• Protein Sequence:
  Sequence Link

  >RC200462 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKG
  GYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTG
  KTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISE
  TGKAKYKA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000185
• RefSeq Size: 1435
• RefSeq ORF: 654
• Synonyms: HGPRT; HPRT
• Locus ID: 3251
• UniProt ID: P00492, A0A140VJL3
• Cytogenetics: Xq26.2-q26.3
• Summary: 'The protein encoded by this gene is a transferase, which catalyzes conversion of hypoxanthine to inosine monophosphate and guanine to guanosine monophosphate via transfer of the 5-phosphoribosyl group from 5-phosphoribosyl 1-pyrophosphate. This enzyme plays a central role in the generation of purine nucleotides through the purine salvage pathway. Mutations in this gene result in Lesch-Nyhan syndrome or gout.[provided by RefSeq, Jun 2009]'
• Protein Families: Druggable Genome, Stem cell - Pluripotency
• Protein Pathways: Drug metabolism - other enzymes, Metabolic pathways, Purine metabolism