Acidic Calponin (CNN3) (NM_001839) Human Mass Spec Standard

CAT#: PH300488

CNN3 MS Standard C13 and N15-labeled recombinant protein (NP_001830)

Product Images

Coomassie blue staining of purified CNN3 protein (Cat# TP300488). The protein was produced from HEK293T cells transfected with CNN3 cDNA clone (Cat# RC200488) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200488
• Predicted MW: 36.4 kDa
• Protein Sequence:
  Sequence Link

  >RC200488 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTHFNKGPSYGLSAEVKNKIASKYDHQAEEDLRNWIEEVTGMSIGPNFQLGLKDGIILCELINKLQPGSV
  KKVNESSLNWPQLENIGNFIKAIQAYGMKPHDIFEANDLFENGNMTQVQTTLVALAGLAKTKGFHTTIDI
  GVKYAEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTDKPFDQTTISLQMGT
  NKGASQAGMLAPGTRRDIYDQKLTLQPVDNSTISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPV
  IHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRDYQYSDQGIDY
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001830
• RefSeq Size: 2112
• RefSeq ORF: 987
• Synonyms: calponin, acidic; calponin 3; calponin 3, acidic; dJ639P13.2.2 (acidic calponin 3)
• Locus ID: 1266
• UniProt ID: Q15417
• Cytogenetics: 1p21.3
• Summary: 'This gene encodes a protein with a markedly acidic C terminus; the basic N-terminus is highly homologous to the N-terminus of a related gene, CNN1. Members of the CNN gene family all contain similar tandemly repeated motifs. This encoded protein is associated with the cytoskeleton but is not involved in contraction. [provided by RefSeq, Jul 2008]'