Dynein light chain (DNAL4) (NM_005740) Human Mass Spec Standard

CAT#: PH300520

DNAL4 MS Standard C13 and N15-labeled recombinant protein (NP_005731)

Product Images

Coomassie blue staining of purified DNAL4 protein (Cat# TP300520). The protein was produced from HEK293T cells transfected with DNAL4 cDNA clone (Cat# RC200520) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200520
• Predicted MW: 12 kDa
• Protein Sequence:
  Sequence Link

  >RC200520 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGETEGKKDEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEKFSNNNESAAKMIKETMDKKFGSSWH
  VVIGEGFGFEITHEVKNLLYLYFGGTLAVCVWKCS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005731
• RefSeq Size: 1504
• RefSeq ORF: 315
• Synonyms: MRMV3; PIG27
• Locus ID: 10126
• UniProt ID: O96015
• Cytogenetics: 22q13.1
• Summary: This gene encodes an axonemal dynein light chain which functions as a component of the outer dynein arms complex. This complex acts as the molecular motor that provides the force to move cilia in an ATP-dependent manner. The encoded protein is expressed in tissues with motile cilia or flagella and may be involved in the movement of sperm flagella. [provided by RefSeq, Dec 2014]
• Protein Pathways: Huntington's disease