Dynein light chain (DNAL4) (NM_005740) Human Recombinant Protein

CAT#: TP300520

Recombinant protein of human dynein, axonemal, light chain 4 (DNAL4)

Product Images

Coomassie blue staining of purified DNAL4 protein (Cat# TP300520). The protein was produced from HEK293T cells transfected with DNAL4 cDNA clone (Cat# RC200520) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200520 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGETEGKKDEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEKFSNNNESAAKMIKETMDKKFGSSWH
  VVIGEGFGFEITHEVKNLLYLYFGGTLAVCVWKCS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 11.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005731
• Locus ID: 10126
• UniProt ID: O96015
• Cytogenetics: 22q13.1
• Refseq Size: 1504
• Refseq ORF: 315
• Synonyms: MRMV3; PIG27
• Summary: This gene encodes an axonemal dynein light chain which functions as a component of the outer dynein arms complex. This complex acts as the molecular motor that provides the force to move cilia in an ATP-dependent manner. The encoded protein is expressed in tissues with motile cilia or flagella and may be involved in the movement of sperm flagella. [provided by RefSeq, Dec 2014]
• Protein Pathways: Huntington's disease