PSMG1 (NM_003720) Human Mass Spec Standard

CAT#: PH300550

PSMG1 MS Standard C13 and N15-labeled recombinant protein (NP_003711)

Product Images

Coomassie blue staining of purified PSMG1 protein (Cat# TP300550). The protein was produced from HEK293T cells transfected with PSMG1 cDNA clone (Cat# RC200550) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200550
• Predicted MW: 32.9 kDa
• Protein Sequence:
  Sequence Link

  >RC200550 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAATFFGEVVKAPCRAGTEDEEEEEEGRRETPEDREVRLQLARKREVRLLRRQTKTSLEVSLLEKYPCSK
  FIIAIGNNAVAFLSSFVMNSGVWEEVGCAKLWNEWCRTTDTTHLSSTEAFCVFYHLKSNPSVFLCQCSCY
  VAEDQQYQWLEKVFGSCPRKNMQITILTCRHVTDYKTSESTGSLPSPFLRALKTQNFKDSACCPLLEQPN
  IVHDLPAAVLSYCQVWKIPAILYLCYTDVMKLDLITVEAFKPILSTRSLKGLVKNIPQSTEILKKLMTTN
  EIQSNIYT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003711
• RefSeq Size: 1140
• RefSeq ORF: 864
• Synonyms: C21LRP; DSCR2; LRPC21; PAC-1; PAC1
• Locus ID: 8624
• UniProt ID: O95456
• Cytogenetics: 21q22.2