Synaptogyrin 1 (SYNGR1) (NM_145731) Human Mass Spec Standard

CAT#: PH300562

SYNGR1 MS Standard C13 and N15-labeled recombinant protein (NP_663783)

Product Images

Coomassie blue staining of purified SYNGR1 protein (Cat# TP300562). The protein was produced from HEK293T cells transfected with SYNGR1 cDNA clone (Cat# RC200562) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200562
• Predicted MW: 21 kDa
• Protein Sequence:
  Sequence Link

  >RC200562 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEGGAYGAGKAGGAFDPYTLVRQPHTILRVVSWLFSIVVFGSIVNEGYLNSASEGEEFCIYNRNPNACSY
  GVAVGVLAFLTCLLYLALDVYFPQISSVKDRKKAVLSDIGVSAFWAFLWFVGFCYLANQWQVSKPKDNPL
  NEGTDAARAAIAFSFFSIFTWSLTAALAVRRFKDLSFQEEYSTLFPASAQP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_663783
• RefSeq Size: 1341
• RefSeq ORF: 573
• Synonyms: MGC1939
• Locus ID: 9145
• UniProt ID: O43759
• Cytogenetics: 22q13.1
• Summary: This gene encodes an integral membrane protein associated with presynaptic vesicles in neuronal cells. The exact function of this protein is unclear, but studies of a similar murine protein suggest that it functions in synaptic plasticity without being required for synaptic transmission. The gene product belongs to the synaptogyrin gene family. Three alternatively spliced variants encoding three different isoforms have been identified. [provided by RefSeq, Jul 2008]
• Protein Families: Transmembrane