Synaptogyrin 1 (SYNGR1) (NM_145731) Human Recombinant Protein
CAT#: TP300562
Recombinant protein of human synaptogyrin 1 (SYNGR1), transcript variant 1b
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200562 protein sequence
Red=Cloning site Green=Tags(s) MEGGAYGAGKAGGAFDPYTLVRQPHTILRVVSWLFSIVVFGSIVNEGYLNSASEGEEFCIYNRNPNACSY GVAVGVLAFLTCLLYLALDVYFPQISSVKDRKKAVLSDIGVSAFWAFLWFVGFCYLANQWQVSKPKDNPL NEGTDAARAAIAFSFFSIFTWSLTAALAVRRFKDLSFQEEYSTLFPASAQP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.9 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_663783 |
Locus ID | 9145 |
UniProt ID | O43759 |
Cytogenetics | 22q13.1 |
Refseq Size | 1341 |
Refseq ORF | 573 |
Summary | This gene encodes an integral membrane protein associated with presynaptic vesicles in neuronal cells. The exact function of this protein is unclear, but studies of a similar murine protein suggest that it functions in synaptic plasticity without being required for synaptic transmission. The gene product belongs to the synaptogyrin gene family. Three alternatively spliced variants encoding three different isoforms have been identified. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407866 | SYNGR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY407866 | Transient overexpression lysate of synaptogyrin 1 (SYNGR1), transcript variant 1b |
USD 396.00 |
|
PH300562 | SYNGR1 MS Standard C13 and N15-labeled recombinant protein (NP_663783) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review