ID3 (NM_002167) Human Mass Spec Standard

CAT#: PH300583

ID3 MS Standard C13 and N15-labeled recombinant protein (NP_002158)

Product Images

Coomassie blue staining of purified ID3 protein (Cat# TP300583). The protein was produced from HEK293T cells transfected with ID3 cDNA clone (Cat# RC200583) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200583
• Predicted MW: 13 kDa
• Protein Sequence:
  Sequence Link

  >RC200583 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEIL
  QRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELAPELVISNDKRSFCH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002158
• RefSeq Size: 1252
• RefSeq ORF: 357
• Synonyms: bHLHb25; HEIR-1
• Locus ID: 3399
• UniProt ID: Q02535
• Cytogenetics: 1p36.12
• Summary: 'The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with other HLH proteins. However, the encoded protein lacks a basic DNA-binding domain and therefore inhibits the DNA binding of any HLH protein with which it interacts. [provided by RefSeq, Aug 2011]'
• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors
• Protein Pathways: TGF-beta signaling pathway