ID3 (NM_002167) Human Recombinant Protein
CAT#: TP300583
Recombinant protein of human inhibitor of DNA binding 3, dominant negative helix-loop-helix protein (ID3)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200583 protein sequence
Red=Cloning site Green=Tags(s) MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEIL QRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELAPELVISNDKRSFCH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 12.8 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002158 |
Locus ID | 3399 |
UniProt ID | Q02535 |
Cytogenetics | 1p36.12 |
Refseq Size | 1252 |
Refseq ORF | 357 |
Synonyms | bHLHb25; HEIR-1 |
Summary | The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with other HLH proteins. However, the encoded protein lacks a basic DNA-binding domain and therefore inhibits the DNA binding of any HLH protein with which it interacts. [provided by RefSeq, Aug 2011] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors |
Protein Pathways | TGF-beta signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419492 | ID3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY419492 | Transient overexpression lysate of inhibitor of DNA binding 3, dominant negative helix-loop-helix protein (ID3) |
USD 396.00 |
|
PH300583 | ID3 MS Standard C13 and N15-labeled recombinant protein (NP_002158) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review