Apoptosis repressor with CARD (NOL3) (NM_003946) Human Mass Spec Standard

CAT#: PH300591

NOL3 MS Standard C13 and N15-labeled recombinant protein (NP_003937)

Product Images

Coomassie blue staining of purified NOL3 protein (Cat# TP300591). The protein was produced from HEK293T cells transfected with NOL3 cDNA clone (Cat# RC200591) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200591
• Predicted MW: 22.6 kDa
• Protein Sequence:
  Sequence Link

  >RC200591 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGE
  AACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPE
  GSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003937
• RefSeq Size: 1540
• RefSeq ORF: 624
• Synonyms: ARC; FCM; MYOCL1; MYP; NOP; NOP30
• Locus ID: 8996
• UniProt ID: O60936, Q5TZN6
• Cytogenetics: 16q22.1
• Summary: This gene encodes an anti-apoptotic protein that has been shown to down-regulate the enzyme activities of caspase 2, caspase 8 and tumor protein p53. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010]