Apoptosis repressor with CARD (NOL3) (NM_003946) Human Recombinant Protein

CAT#: TP300591

Recombinant protein of human nucleolar protein 3 (apoptosis repressor with CARD domain) (NOL3)

Product Images

Coomassie blue staining of purified NOL3 protein (Cat# TP300591). The protein was produced from HEK293T cells transfected with NOL3 cDNA clone (Cat# RC200591) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200591 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGE
  AACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPE
  GSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 22.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_003937
• Locus ID: 8996
• UniProt ID: O60936, Q5TZN6
• Cytogenetics: 16q22.1
• Refseq Size: 1540
• Refseq ORF: 624
• Synonyms: ARC; FCM; MYOCL1; MYP; NOP; NOP30
• Summary: This gene encodes an anti-apoptotic protein that has been shown to down-regulate the enzyme activities of caspase 2, caspase 8 and tumor protein p53. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010]