ESE1 (ELF3) (NM_004433) Human Mass Spec Standard

CAT#: PH300631

ELF3 MS Standard C13 and N15-labeled recombinant protein (NP_004424)

Product Images

Coomassie blue staining of purified ELF3 protein (Cat# TP300631). The protein was produced from HEK293T cells transfected with ELF3 cDNA clone (Cat# RC200631) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200631
• Predicted MW: 41.5 kDa
• Protein Sequence:
  Sequence Link

  >RC200631 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAATCEISNIFSNYFSAMYSSEDSTLASVPPAATFGADDLVLTLSNPQMSLEGTEKASWLGEQPQFWSKT
  QVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQLHAQLRDLTSSSSDELSWII
  ELLEKDGMAFQEALDPGPFDQGSPFAQELLDDGQQASPYHPGSCGAGAPSPGSSDVSTAGTGASRSSHSS
  DSGGSDVDLDPTDGKLFPSDGFRDCKKGDPKHGKRKRGRPRKLSKEYWDCLEGKKSKHAPRGTHLWEFIR
  DILIHPELNEGLMKWENRHEGVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREILERVDGRRL
  VYKFGKNSSGWKEEEVLQSRN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004424
• RefSeq Size: 3149
• RefSeq ORF: 1113
• Synonyms: EPR-1; ERT; ESE-1; ESX
• Locus ID: 1999
• UniProt ID: P78545, A0A024R974
• Cytogenetics: 1q32.1
• Summary: ''
• Protein Families: Transcription Factors