ESE1 (ELF3) (NM_004433) Human Recombinant Protein
CAT#: TP300631
Recombinant protein of human E74-like factor 3 (ets domain transcription factor, epithelial-specific ) (ELF3), transcript variant 1
View other "ELF3" proteins (5)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200631 protein sequence
Red=Cloning site Green=Tags(s) MAATCEISNIFSNYFSAMYSSEDSTLASVPPAATFGADDLVLTLSNPQMSLEGTEKASWLGEQPQFWSKT QVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQLHAQLRDLTSSSSDELSWII ELLEKDGMAFQEALDPGPFDQGSPFAQELLDDGQQASPYHPGSCGAGAPSPGSSDVSTAGTGASRSSHSS DSGGSDVDLDPTDGKLFPSDGFRDCKKGDPKHGKRKRGRPRKLSKEYWDCLEGKKSKHAPRGTHLWEFIR DILIHPELNEGLMKWENRHEGVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREILERVDGRRL VYKFGKNSSGWKEEEVLQSRN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 41.3 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004424 |
Locus ID | 1999 |
UniProt ID | P78545, A0A024R974 |
Cytogenetics | 1q32.1 |
Refseq Size | 3149 |
Refseq ORF | 1113 |
Synonyms | EPR-1; ERT; ESE-1; ESX |
Summary | Transcriptional activator that binds and transactivates ETS sequences containing the consensus nucleotide core sequence GGA[AT]. Acts synergistically with POU2F3 to transactivate the SPRR2A promoter and with RUNX1 to transactivate the ANGPT1 promoter. Also transactivates collagenase, CCL20, CLND7, FLG, KRT8, NOS2, PTGS2, SPRR2B, TGFBR2 and TGM3 promoters. Represses KRT4 promoter activity. Involved in mediating vascular inflammation. May play an important role in epithelial cell differentiation and tumorigenesis. May be a critical downstream effector of the ERBB2 signaling pathway. May be associated with mammary gland development and involution. Plays an important role in the regulation of transcription with TATA-less promoters in preimplantation embryos, which is essential in preimplantation development (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401407 | ELF3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC426477 | ELF3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401407 | Transient overexpression lysate of E74-like factor 3 (ets domain transcription factor, epithelial-specific ) (ELF3), transcript variant 1 |
USD 396.00 |
|
LY426477 | Transient overexpression lysate of E74-like factor 3 (ets domain transcription factor, epithelial-specific ) (ELF3), transcript variant 2 |
USD 396.00 |
|
PH300631 | ELF3 MS Standard C13 and N15-labeled recombinant protein (NP_004424) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review