SERPINB9 (NM_004155) Human Mass Spec Standard

CAT#: PH300645

SERPINB9 MS Standard C13 and N15-labeled recombinant protein (NP_004146)

Product Images

Coomassie blue staining of purified SERPINB9 protein (Cat# TP300645). The protein was produced from HEK293T cells transfected with SERPINB9 cDNA clone (Cat# RC200645) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200645
• Predicted MW: 42.4 kDa
• Protein Sequence:
  Sequence Link

  >RC200645 protein sequence
  Red=Cloning site Green=Tags(s)
  
  METLSNASGTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSLNTEEDIHRAF
  QSLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIRAAEESRKHINTWVSKKT
  EGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVG
  EVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYDM
  ESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFC
  ADHPFLFFIRHNRANSILFCGRFSSP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004146
• RefSeq Size: 4167
• RefSeq ORF: 1128
• Synonyms: CAP-3; CAP3; PI-9; PI9
• Locus ID: 5272
• UniProt ID: P50453, A0A024QZT4
• Cytogenetics: 6p25.2
• Summary: 'This gene encodes a member of the serine protease inhibitor family which are also known as serpins. The encoded protein belongs to a subfamily of intracellular serpins. This protein inhibits the activity of the effector molecule granzyme B. Overexpression of this protein may prevent cytotoxic T-lymphocytes from eliminating certain tumor cells. A pseudogene of this gene is found on chromosome 6. [provided by RefSeq, Mar 2012]'
• Protein Families: Druggable Genome