SERPINB9 (NM_004155) Human Recombinant Protein

CAT#: TP300645

Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 9 (SERPINB9)

Product Images

Coomassie blue staining of purified SERPINB9 protein (Cat# TP300645). The protein was produced from HEK293T cells transfected with SERPINB9 cDNA clone (Cat# RC200645) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200645 protein sequence
  Red=Cloning site Green=Tags(s)
  
  METLSNASGTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSLNTEEDIHRAF
  QSLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIRAAEESRKHINTWVSKKT
  EGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVG
  EVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYDM
  ESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFC
  ADHPFLFFIRHNRANSILFCGRFSSP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 42.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004146
• Locus ID: 5272
• UniProt ID: P50453, A0A024QZT4
• Cytogenetics: 6p25.2
• Refseq Size: 4167
• Refseq ORF: 1128
• Synonyms: CAP-3; CAP3; PI-9; PI9
• Summary: This gene encodes a member of the serine protease inhibitor family which are also known as serpins. The encoded protein belongs to a subfamily of intracellular serpins. This protein inhibits the activity of the effector molecule granzyme B. Overexpression of this protein may prevent cytotoxic T-lymphocytes from eliminating certain tumor cells. A pseudogene of this gene is found on chromosome 6. [provided by RefSeq, Mar 2012]
• Protein Families: Druggable Genome