SERPINB9 (NM_004155) Human Recombinant Protein
CAT#: TP300645
Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 9 (SERPINB9)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200645 protein sequence
Red=Cloning site Green=Tags(s) METLSNASGTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSLNTEEDIHRAF QSLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIRAAEESRKHINTWVSKKT EGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVG EVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYDM ESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFC ADHPFLFFIRHNRANSILFCGRFSSP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 42.2 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004146 |
Locus ID | 5272 |
UniProt ID | P50453, A0A024QZT4 |
Cytogenetics | 6p25.2 |
Refseq Size | 4167 |
Refseq ORF | 1128 |
Synonyms | CAP-3; CAP3; PI-9; PI9 |
Summary | This gene encodes a member of the serine protease inhibitor family which are also known as serpins. The encoded protein belongs to a subfamily of intracellular serpins. This protein inhibits the activity of the effector molecule granzyme B. Overexpression of this protein may prevent cytotoxic T-lymphocytes from eliminating certain tumor cells. A pseudogene of this gene is found on chromosome 6. [provided by RefSeq, Mar 2012] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418182 | SERPINB9 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY418182 | Transient overexpression lysate of serpin peptidase inhibitor, clade B (ovalbumin), member 9 (SERPINB9) |
USD 396.00 |
|
PH300645 | SERPINB9 MS Standard C13 and N15-labeled recombinant protein (NP_004146) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review