Lysozyme (LYZ) (NM_000239) Human Mass Spec Standard

CAT#: PH300730

LYZ MS Standard C13 and N15-labeled recombinant protein (NP_000230)

Product Images

Coomassie blue staining of purified LYZ protein (Cat# TP300730). The protein was produced from HEK293T cells transfected with LYZ cDNA clone (Cat# RC200730) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200730
• Predicted MW: 16.5 kDa
• Protein Sequence:
  Sequence Link

  >RC200730 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRST
  DYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVR
  QYVQGCGV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000230
• RefSeq Size: 1516
• RefSeq ORF: 444
• Synonyms: LYZF1; LZM
• Locus ID: 4069
• UniProt ID: P61626, B2R4C5
• Cytogenetics: 12q15
• Summary: 'This gene encodes human lysozyme, whose natural substrate is the bacterial cell wall peptidoglycan (cleaving the beta[1-4]glycosidic linkages between N-acetylmuramic acid and N-acetylglucosamine). Lysozyme is one of the antimicrobial agents found in human milk, and is also present in spleen, lung, kidney, white blood cells, plasma, saliva, and tears. The protein has antibacterial activity against a number of bacterial species. Missense mutations in this gene have been identified in heritable renal amyloidosis. [provided by RefSeq, Oct 2014]'
• Protein Families: Druggable Genome