Lysozyme (LYZ) (NM_000239) Human Recombinant Protein
CAT#: TP300730
Recombinant protein of human lysozyme (renal amyloidosis) (LYZ)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200730 protein sequence
Red=Cloning site Green=Tags(s) MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRST DYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVR QYVQGCGV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14.7 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000230 |
Locus ID | 4069 |
UniProt ID | P61626, B2R4C5 |
Cytogenetics | 12q15 |
Refseq Size | 1516 |
Refseq ORF | 444 |
Synonyms | LYZF1; LZM |
Summary | This gene encodes human lysozyme, whose natural substrate is the bacterial cell wall peptidoglycan (cleaving the beta[1-4]glycosidic linkages between N-acetylmuramic acid and N-acetylglucosamine). Lysozyme is one of the antimicrobial agents found in human milk, and is also present in spleen, lung, kidney, white blood cells, plasma, saliva, and tears. The protein has antibacterial activity against a number of bacterial species. Missense mutations in this gene have been identified in heritable renal amyloidosis. [provided by RefSeq, Oct 2014] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400091 | LYZ HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY400091 | Transient overexpression lysate of lysozyme (renal amyloidosis) (LYZ) |
USD 396.00 |
|
PH300730 | LYZ MS Standard C13 and N15-labeled recombinant protein (NP_000230) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review