MAD3 (MXD3) (NM_031300) Human Mass Spec Standard

CAT#: PH300747

MXD3 MS Standard C13 and N15-labeled recombinant protein (NP_112590)

Product Images

Coomassie blue staining of purified MXD3 protein (Cat# TP300747). The protein was produced from HEK293T cells transfected with MXD3 cDNA clone (Cat# RC200747) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200747
• Predicted MW: 23.5 kDa
• Protein Sequence:
  Sequence Link

  >RC200747 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEPLASNIQVLLQAAEFLERREREAEHGYASLCPHRSPGPIHRRKKRPPQAPGAQDSGRSVHNELEKRRR
  AQLKRCLERLKQQMPLGADCARYTTLSLLRRARMHIQKLEDQEQRARQLKERLRSKQQSLQRQLEQLRGL
  AGAAERERLRADSLDSSGLSSERSDSDQEELEVDVESLVFGGEAELLRGFVAGQEHSYSHGGGAWL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_112590
• RefSeq Size: 1483
• RefSeq ORF: 618
• Synonyms: BHLHC13; MAD3; MYX
• Locus ID: 83463
• UniProt ID: Q9BW11, A0A024R7S0
• Cytogenetics: 5q35.3
• Summary: This gene encodes a member of the Myc superfamily of basic helix-loop-helix leucine zipper transcriptional regulators. The encoded protein forms a heterodimer with the cofactor MAX which binds specific E-box DNA motifs in the promoters of target genes and regulates their transcription. Disruption of the MAX-MXD3 complex is associated with uncontrolled cell proliferation and tumorigenesis. Transcript variants of this gene encoding different isoforms have been described. [provided by RefSeq, Dec 2008]
• Protein Families: Druggable Genome, Transcription Factors