EIF5A (NM_001970) Human Mass Spec Standard
CAT#: PH300770
EIF5A MS Standard C13 and N15-labeled recombinant protein (NP_001961)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200770 |
Predicted MW | 16.8 kDa |
Protein Sequence |
>RC200770 protein sequence
Red=Cloning site Green=Tags(s) MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYE DICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSA MTEEAAVAIKAMAK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001961 |
RefSeq Size | 1355 |
RefSeq ORF | 462 |
Synonyms | EIF-5A; EIF5A1; eIF5AI |
Locus ID | 1984 |
UniProt ID | P63241 |
Cytogenetics | 17p13.1 |
Summary | '' |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419616 | EIF5A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428326 | EIF5A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428327 | EIF5A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY419616 | Transient overexpression lysate of eukaryotic translation initiation factor 5A (EIF5A), transcript variant B |
USD 396.00 |
|
LY428326 | Transient overexpression lysate of eukaryotic translation initiation factor 5A (EIF5A), transcript variant C |
USD 396.00 |
|
LY428327 | Transient overexpression lysate of eukaryotic translation initiation factor 5A (EIF5A), transcript variant D |
USD 396.00 |
|
PH326600 | EIF5A MS Standard C13 and N15-labeled recombinant protein (NP_001137233) |
USD 2,055.00 |
|
PH326664 | EIF5A MS Standard C13 and N15-labeled recombinant protein (NP_001137234) |
USD 2,055.00 |
|
TP300770 | Recombinant protein of human eukaryotic translation initiation factor 5A (EIF5A), transcript variant B |
USD 823.00 |
|
TP326600 | Recombinant protein of human eukaryotic translation initiation factor 5A (EIF5A), transcript variant C |
USD 748.00 |
|
TP326664 | Recombinant protein of human eukaryotic translation initiation factor 5A (EIF5A), transcript variant D |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review