EIF5A (NM_001970) Human Mass Spec Standard

CAT#: PH300770

EIF5A MS Standard C13 and N15-labeled recombinant protein (NP_001961)

Product Images

Coomassie blue staining of purified EIF5A protein (Cat# TP300770). The protein was produced from HEK293T cells transfected with EIF5A cDNA clone (Cat# RC200770) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200770
• Predicted MW: 16.8 kDa
• Protein Sequence:
  Sequence Link

  >RC200770 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYE
  DICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSA
  MTEEAAVAIKAMAK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001961
• RefSeq Size: 1355
• RefSeq ORF: 462
• Synonyms: EIF-5A; EIF5A1; eIF5AI
• Locus ID: 1984
• UniProt ID: P63241
• Cytogenetics: 17p13.1
• Summary: ''