RhoGDI (ARHGDIA) (NM_004309) Human Mass Spec Standard
CAT#: PH300902
ARHGDIA MS Standard C13 and N15-labeled recombinant protein (NP_004300)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200902 |
| Predicted MW | 23.2 kDa |
| Protein Sequence |
>RC200902 protein sequence
Red=Cloning site Green=Tags(s) MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNV VVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKID KTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_004300 |
| RefSeq Size | 1920 |
| RefSeq ORF | 612 |
| Synonyms | GDIA1; HEL-S-47e; NPHS8; RHOGDI; RHOGDI-1 |
| Locus ID | 396 |
| UniProt ID | P52565, V9HWE8 |
| Cytogenetics | 17q25.3 |
| Summary | 'This gene encodes a protein that plays a key role in the regulation of signaling through Rho GTPases. The encoded protein inhibits the disassociation of Rho family members from GDP (guanine diphosphate), thereby maintaining these factors in an inactive state. Activity of this protein is important in a variety of cellular processes, and expression of this gene may be altered in tumors. Mutations in this gene have been found in individuals with nephrotic syndrome, type 8. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]' |
| Protein Families | Druggable Genome |
| Protein Pathways | Neurotrophin signaling pathway |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401371 | ARHGDIA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC434003 | ARHGDIA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY401371 | Transient overexpression lysate of Rho GDP dissociation inhibitor (GDI) alpha (ARHGDIA) |
USD 436.00 |
|
| LY434003 | Transient overexpression lysate of Rho GDP dissociation inhibitor (GDI) alpha (ARHGDIA), transcript variant 3 |
USD 436.00 |
|
| TP300902 | Recombinant protein of human Rho GDP dissociation inhibitor (GDI) alpha (ARHGDIA) |
USD 823.00 |
|
| TP331004 | Purified recombinant protein of Homo sapiens Rho GDP dissociation inhibitor (GDI) alpha (ARHGDIA), transcript variant 3. |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China