RhoGDI (ARHGDIA) (NM_004309) Human Recombinant Protein

CAT#: TP300902

Recombinant protein of human Rho GDP dissociation inhibitor (GDI) alpha (ARHGDIA)

Product Images

Coomassie blue staining of purified ARHGDIA protein (Cat# TP300902). The protein was produced from HEK293T cells transfected with ARHGDIA cDNA clone (Cat# RC200902) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200902 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNV
  VVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKID
  KTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 23 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004300
• Locus ID: 396
• UniProt ID: P52565, V9HWE8
• Cytogenetics: 17q25.3
• Refseq Size: 1920
• Refseq ORF: 612
• Synonyms: GDIA1; HEL-S-47e; NPHS8; RHOGDI; RHOGDI-1
• Summary: This gene encodes a protein that plays a key role in the regulation of signaling through Rho GTPases. The encoded protein inhibits the disassociation of Rho family members from GDP (guanine diphosphate), thereby maintaining these factors in an inactive state. Activity of this protein is important in a variety of cellular processes, and expression of this gene may be altered in tumors. Mutations in this gene have been found in individuals with nephrotic syndrome, type 8. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
• Protein Families: Druggable Genome
• Protein Pathways: Neurotrophin signaling pathway