RhoGDI (ARHGDIA) (NM_004309) Human Recombinant Protein
CAT#: TP300902
Recombinant protein of human Rho GDP dissociation inhibitor (GDI) alpha (ARHGDIA)
View other "ARHGDIA" proteins (6)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200902 protein sequence
Red=Cloning site Green=Tags(s) MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNV VVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKID KTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 23 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004300 |
Locus ID | 396 |
UniProt ID | P52565, V9HWE8 |
Cytogenetics | 17q25.3 |
Refseq Size | 1920 |
Refseq ORF | 612 |
Synonyms | GDIA1; HEL-S-47e; NPHS8; RHOGDI; RHOGDI-1 |
Summary | This gene encodes a protein that plays a key role in the regulation of signaling through Rho GTPases. The encoded protein inhibits the disassociation of Rho family members from GDP (guanine diphosphate), thereby maintaining these factors in an inactive state. Activity of this protein is important in a variety of cellular processes, and expression of this gene may be altered in tumors. Mutations in this gene have been found in individuals with nephrotic syndrome, type 8. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014] |
Protein Families | Druggable Genome |
Protein Pathways | Neurotrophin signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401371 | ARHGDIA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC434003 | ARHGDIA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401371 | Transient overexpression lysate of Rho GDP dissociation inhibitor (GDI) alpha (ARHGDIA) |
USD 396.00 |
|
LY434003 | Transient overexpression lysate of Rho GDP dissociation inhibitor (GDI) alpha (ARHGDIA), transcript variant 3 |
USD 396.00 |
|
PH300902 | ARHGDIA MS Standard C13 and N15-labeled recombinant protein (NP_004300) |
USD 2,055.00 |
|
TP331004 | Purified recombinant protein of Homo sapiens Rho GDP dissociation inhibitor (GDI) alpha (ARHGDIA), transcript variant 3. |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review