ABHD6 (NM_020676) Human Mass Spec Standard

CAT#: PH300915

ABHD6 MS Standard C13 and N15-labeled recombinant protein (NP_065727)

Product Images

Coomassie blue staining of purified ABHD6 protein (Cat# TP300915). The protein was produced from HEK293T cells transfected with ABHD6 cDNA clone (Cat# RC200915) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200915
• Predicted MW: 38.3 kDa
• Protein Sequence:
  Sequence Link

  >RC200915 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVHHEDYQFCYSFRGRPGH
  KPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLSIDGQVKRIHQFVECLKLNKK
  PFHLVGTSMGGQVAGVYAAYYPSDVSSLCLVCPAGLQYSTDNQFVQRLKELQGSAAVEKIPLIPSTPEEM
  SEMLQLCSYVRFKVPQQILQGLVDVRIPHNNFYRKLFLEIVSEKSRYSLHQNMDKIKVPTQIIWGKQDQV
  LDVSGADMLAKSIANCQVELLENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_065727
• RefSeq Size: 2413
• RefSeq ORF: 1011
• Synonyms: abhydrolase domain containing 6; lipase protein
• Locus ID: 57406
• UniProt ID: Q9BV23, A0A024R323
• Cytogenetics: 3p14.3
• Protein Families: Transmembrane