MRI1 (NM_001031727) Human Mass Spec Standard

CAT#: PH300993

MRI1 MS Standard C13 and N15-labeled recombinant protein (NP_001026897)

Product Images

Coomassie blue staining of purified MRI1 protein (Cat# TP300993). The protein was produced from HEK293T cells transfected with MRI1 cDNA clone (Cat# RC200993) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200993
• Predicted MW: 39.1 kDa
• Protein Sequence:
  Sequence Link

  >RC200993 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTLEAIRYSRGSLQILDQLLLPKQSRYEAVGSVHQAWEAIRAMKVRGAPAIALVGCLSLAVELQAGAGGP
  GLAALVAFVRDKLSFLVTARPTAVNMARAARDLADVAAREAEREGATEEAVRERVICCTEDMLEKDLRDN
  RSIGDLGARHLLERVAPSGGKVTVLTHCNTGALATAGYGTALGVIRSLHSLGRLEHAFCTETRPYNQGAR
  LTAFELVYEQIPATLITDSMVAAAMAHRGVSAVVVGADRVVANGDTANKVGTYQLAIVAKHHGIPFYVAA
  PSSSCDLRLETGKEIIIEERPGQELTDVNGVRIAAPGIGVWNPAFDVTPHDLITGGIITELGVFAPEELR
  TALTTTISSRDGTLDGPQM
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001026897
• RefSeq Size: 3177
• RefSeq ORF: 1107
• Synonyms: M1Pi; MRDI; MTNA; Ypr118w
• Locus ID: 84245
• UniProt ID: Q9BV20
• Cytogenetics: 19p13.13
• Summary: This enzyme functions in the methionine salvage pathway by catalyzing the interconversion of methylthioribose-1-phosphate and methythioribulose-1-phosphate. Elevated expression of the encoded protein is associated with metastatic melanoma and this protein promotes melanoma cell invasion independent of its enzymatic activity. Mutations in this gene may be associated with vanishing white matter disease (VMWD). [provided by RefSeq, Jul 2016]