MRI1 (NM_001031727) Human Recombinant Protein

CAT#: TP300993

Recombinant protein of human methylthioribose-1-phosphate isomerase homolog (S. cerevisiae) (MRI1), transcript variant 1

Product Images

Coomassie blue staining of purified MRI1 protein (Cat# TP300993). The protein was produced from HEK293T cells transfected with MRI1 cDNA clone (Cat# RC200993) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200993 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTLEAIRYSRGSLQILDQLLLPKQSRYEAVGSVHQAWEAIRAMKVRGAPAIALVGCLSLAVELQAGAGGP
  GLAALVAFVRDKLSFLVTARPTAVNMARAARDLADVAAREAEREGATEEAVRERVICCTEDMLEKDLRDN
  RSIGDLGARHLLERVAPSGGKVTVLTHCNTGALATAGYGTALGVIRSLHSLGRLEHAFCTETRPYNQGAR
  LTAFELVYEQIPATLITDSMVAAAMAHRGVSAVVVGADRVVANGDTANKVGTYQLAIVAKHHGIPFYVAA
  PSSSCDLRLETGKEIIIEERPGQELTDVNGVRIAAPGIGVWNPAFDVTPHDLITGGIITELGVFAPEELR
  TALTTTISSRDGTLDGPQM
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 39 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001026897
• Locus ID: 84245
• UniProt ID: Q9BV20
• Cytogenetics: 19p13.13
• Refseq Size: 3177
• Refseq ORF: 1107
• Synonyms: M1Pi; MRDI; MTNA; Ypr118w
• Summary: This enzyme functions in the methionine salvage pathway by catalyzing the interconversion of methylthioribose-1-phosphate and methythioribulose-1-phosphate. Elevated expression of the encoded protein is associated with metastatic melanoma and this protein promotes melanoma cell invasion independent of its enzymatic activity. Mutations in this gene may be associated with vanishing white matter disease (VMWD). [provided by RefSeq, Jul 2016]