Mutarotase (GALM) (NM_138801) Human Mass Spec Standard

CAT#: PH300995

GALM MS Standard C13 and N15-labeled recombinant protein (NP_620156)

Product Images

Coomassie blue staining of purified GALM protein (Cat# TP300995). The protein was produced from HEK293T cells transfected with GALM cDNA clone (Cat# RC200995) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200995
• Predicted MW: 37.8 kDa
• Protein Sequence:
  Sequence Link

  >RC200995 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASVTRAVFGELPSGGGTVEKFQLQSDLLRVDIISWGCTITALEVKDRQGRASDVVLGFAELEGYLQKQP
  YFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEGY
  PGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFNLAGQASPNINDHEVTIEADTYLPVDETLIP
  TGEVAPVQGTAFDLRKPVELGKHLQDFHLNGFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQF
  YTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKFSVA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_620156
• RefSeq Size: 2483
• RefSeq ORF: 1026
• Synonyms: BLOCK25; GLAT; HEL-S-63p; IBD1
• Locus ID: 130589
• UniProt ID: Q96C23, A0A384MDW6
• Cytogenetics: 2p22.1
• Summary: This gene encodes an enzyme that catalyzes the epimerization of hexose sugars such as glucose and galactose. The encoded protein is expressed in the cytoplasm and has a preference for galactose. The encoded protein may be required for normal galactose metabolism by maintaining the equilibrium of alpha and beta anomers of galactose. [provided by RefSeq, Mar 2009]
• Protein Pathways: Glycolysis / Gluconeogenesis