CLDND1 (NM_019895) Human Mass Spec Standard

CAT#: PH301014

CLDND1 MS Standard C13 and N15-labeled recombinant protein (NP_063948)

Product Images

Coomassie blue staining of purified CLDND1 protein (Cat# TP301014). The protein was produced from HEK293T cells transfected with CLDND1 cDNA clone (Cat# RC201014) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201014
• Predicted MW: 28.6 kDa
• Protein Sequence:
  Sequence Link

  >RC201014 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYRSPVQENSSDLNKSIWDEFISDEADEKTYNDALFR
  YNGTVGLWRRCITIPKNMHWYSPPERTESFDVVTKCVSFTLTEQFMEKFVDPGNHNSGIDLLRTYLWRCQ
  FLLPFVSLGLMCFGALIGLCACICRSLYPTIATGILHLLAGLCTLGSVSCYVAGIELLHQKLELPDNVSG
  EFGWSFCLACVSAPLQFMASALFIWAAHTNRKEYTLMKAYRVA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_063948
• RefSeq Size: 2244
• RefSeq ORF: 759
• Synonyms: C3orf4; GENX-3745; Z38
• Locus ID: 56650
• UniProt ID: Q9NY35
• Cytogenetics: 3q11.2
• Protein Families: Transmembrane