CLDND1 (NM_019895) Human Recombinant Protein

CAT#: TP301014

Recombinant protein of human claudin domain containing 1 (CLDND1), transcript variant 2

Product Images

Coomassie blue staining of purified CLDND1 protein (Cat# TP301014). The protein was produced from HEK293T cells transfected with CLDND1 cDNA clone (Cat# RC201014) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201014 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYRSPVQENSSDLNKSIWDEFISDEADEKTYNDALFR
  YNGTVGLWRRCITIPKNMHWYSPPERTESFDVVTKCVSFTLTEQFMEKFVDPGNHNSGIDLLRTYLWRCQ
  FLLPFVSLGLMCFGALIGLCACICRSLYPTIATGILHLLAGLCTLGSVSCYVAGIELLHQKLELPDNVSG
  EFGWSFCLACVSAPLQFMASALFIWAAHTNRKEYTLMKAYRVA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 28.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_063948
• Locus ID: 56650
• UniProt ID: Q9NY35
• Cytogenetics: 3q11.2
• Refseq Size: 2244
• Refseq ORF: 759
• Synonyms: C3orf4; GENX-3745; Z38
• Protein Families: Transmembrane