C11ORF67 (AAMDC) (NM_024684) Human Mass Spec Standard

CAT#: PH301033

C11orf67 MS Standard C13 and N15-labeled recombinant protein (NP_078960)

Product Images

Coomassie blue staining of purified AAMDC protein (Cat# TP301033). The protein was produced from HEK293T cells transfected with AAMDC cDNA clone (Cat# RC201033) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201033
• Predicted MW: 13.3 kDa
• Protein Sequence:
  Sequence Link

  >RC201033 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTSPEIASLSWGQMKVKGSNTTYKDCKVWPGGSRTWDWRETGTEHSPGVQPADVKEVVEKGVQTLVIGRG
  MSEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHSTC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_078960
• RefSeq Size: 557
• RefSeq ORF: 366
• Synonyms: C11orf67; CK067; PTD015
• Locus ID: 28971
• UniProt ID: Q9H7C9
• Cytogenetics: 11q14.1
• Summary: May play a role in preadipocyte differentiation and adipogenesis. [UniProtKB/Swiss-Prot Function]