Hsp22 (HSPB8) (NM_014365) Human Mass Spec Standard

CAT#: PH301040

HSPB8 MS Standard C13 and N15-labeled recombinant protein (NP_055180)

Product Images

Coomassie blue staining of purified HSPB8 protein (Cat# TP301040). The protein was produced from HEK293T cells transfected with HSPB8 cDNA clone (Cat# RC201040) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201040
• Predicted MW: 21.6 kDa
• Protein Sequence:
  Sequence Link

  >RC201040 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVP
  RGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFT
  KKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055180
• RefSeq Size: 2056
• RefSeq ORF: 588
• Synonyms: CMT2L; DHMN2; E2IG1; H11; HMN2; HMN2A; HSP22
• Locus ID: 26353
• UniProt ID: Q9UJY1
• Cytogenetics: 12q24.23
• Summary: The protein encoded by this gene belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-terminal part of the molecule. The expression of this gene in induced by estrogen in estrogen receptor-positive breast cancer cells, and this protein also functions as a chaperone in association with Bag3, a stimulator of macroautophagy. Thus, this gene appears to be involved in regulation of cell proliferation, apoptosis, and carcinogenesis, and mutations in this gene have been associated with different neuromuscular diseases, including Charcot-Marie-Tooth disease. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Protein Kinase