Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Antibody against HSPB8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence NELPQDSQEVTCT, from the C Terminus of the protein sequence according to NP_055180.1. |
Rabbit Polyclonal Anti-HSPB8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPB8 antibody: synthetic peptide directed towards the N terminal of human HSPB8. Synthetic peptide located within the following region: ADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDW |
Rabbit Polyclonal Anti-HSPB8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPB8 antibody: synthetic peptide directed towards the middle region of human HSPB8. Synthetic peptide located within the following region: PEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFA |
HSPB8/HSP22 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-196 of human HSPB8/HSP22 (NP_055180.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- HSPB8