PDZD11 (NM_016484) Human Mass Spec Standard

CAT#: PH301049

PDZD11 MS Standard C13 and N15-labeled recombinant protein (NP_057568)

Product Images

Coomassie blue staining of purified PDZD11 protein (Cat# TP301049). The protein was produced from HEK293T cells transfected with PDZD11 cDNA clone (Cat# RC201049) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201049
• Predicted MW: 16.1 kDa
• Protein Sequence:
  Sequence Link

  >RC201049 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDSRIPYDDYPVVFLPAYENPPAWIPPHERVHHPDYNNELTQFLPRTITLKKPPGAQLGFNIRGGKASQL
  GIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVEILKTAREISMRVRFFPYNYHRQKERTVH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057568
• RefSeq Size: 1246
• RefSeq ORF: 420
• Synonyms: AIPP1; PDZK11; PISP
• Locus ID: 51248
• UniProt ID: Q5EBL8
• Cytogenetics: Xq13.1
• Protein Families: Secreted Protein