PDZD11 (NM_016484) Human Recombinant Protein

CAT#: TP301049

Recombinant protein of human PDZ domain containing 11 (PDZD11)

Product Images

Coomassie blue staining of purified PDZD11 protein (Cat# TP301049). The protein was produced from HEK293T cells transfected with PDZD11 cDNA clone (Cat# RC201049) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201049 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDSRIPYDDYPVVFLPAYENPPAWIPPHERVHHPDYNNELTQFLPRTITLKKPPGAQLGFNIRGGKASQL
  GIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVEILKTAREISMRVRFFPYNYHRQKERTVH
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 16 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057568
• Locus ID: 51248
• UniProt ID: Q5EBL8
• Cytogenetics: Xq13.1
• Refseq Size: 1246
• Refseq ORF: 420
• Synonyms: AIPP1; PDZK11; PISP
• Summary: Mediates docking of ADAM10 to zonula adherens by interacting with PLEKHA7 which is required for PLEKHA7 to interact with the ADAM10-binding protein TSPAN33.[UniProtKB/Swiss-Prot Function]
• Protein Families: Secreted Protein