COMMD5 (NM_001081004) Human Mass Spec Standard
CAT#: PH301051
COMMD5 MS Standard C13 and N15-labeled recombinant protein (NP_001074473)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201051 |
Predicted MW | 24.7 kDa |
Protein Sequence |
>RC201051 protein sequence
Red=Cloning site Green=Tags(s) MSAVGAATPYLHHPGDSHSGRVSFLGAQLPPEVAAMARLLGDLDRSTFRKLLKFVVSSLQGEDCREAVQR LGVSANLPEEQLGALLAGMHTLLQQALRLPPTSLKPDTFRDQLQELCIPQDLVGDLASVVFGSQRPLLDS VAQQQGAWLPHVADFRWRVDVAISTSALARSLQPSVLMQLKLSDGSAYRFEVPTAKFQELRYSVALVLKE MADLEKRCERRLQD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001074473 |
RefSeq Size | 1321 |
RefSeq ORF | 672 |
Synonyms | HCARG; HT002 |
Locus ID | 28991 |
UniProt ID | Q9GZQ3 |
Cytogenetics | 8q24.3 |
Protein Families | Druggable Genome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415491 | COMMD5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC421149 | COMMD5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC421150 | COMMD5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425931 | COMMD5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC429409 | COMMD5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY415491 | Transient overexpression lysate of COMM domain containing 5 (COMMD5), transcript variant 1 |
USD 396.00 |
|
LY421149 | Transient overexpression lysate of COMM domain containing 5 (COMMD5), transcript variant 2 |
USD 396.00 |
|
LY421150 | Transient overexpression lysate of COMM domain containing 5 (COMMD5), transcript variant 3 |
USD 396.00 |
|
LY425931 | Transient overexpression lysate of COMM domain containing 5 (COMMD5), transcript variant 2 |
USD 396.00 |
|
LY429409 | Transient overexpression lysate of COMM domain containing 5 (COMMD5), transcript variant 1 |
USD 396.00 |
|
PH309381 | COMMD5 MS Standard C13 and N15-labeled recombinant protein (NP_054785) |
USD 2,055.00 |
|
PH316768 | COMMD5 MS Standard C13 and N15-labeled recombinant protein (NP_001074472) |
USD 2,055.00 |
|
TP301051 | Recombinant protein of human COMM domain containing 5 (COMMD5), transcript variant 3 |
USD 823.00 |
|
TP309381 | Recombinant protein of human COMM domain containing 5 (COMMD5), transcript variant 1 |
USD 823.00 |
|
TP316768 | Recombinant protein of human COMM domain containing 5 (COMMD5), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review