COMMD5 (NM_001081004) Human Mass Spec Standard

CAT#: PH301051

COMMD5 MS Standard C13 and N15-labeled recombinant protein (NP_001074473)

Product Images

Coomassie blue staining of purified COMMD5 protein (Cat# TP301051). The protein was produced from HEK293T cells transfected with COMMD5 cDNA clone (Cat# RC201051) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201051
• Predicted MW: 24.7 kDa
• Protein Sequence:
  Sequence Link

  >RC201051 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSAVGAATPYLHHPGDSHSGRVSFLGAQLPPEVAAMARLLGDLDRSTFRKLLKFVVSSLQGEDCREAVQR
  LGVSANLPEEQLGALLAGMHTLLQQALRLPPTSLKPDTFRDQLQELCIPQDLVGDLASVVFGSQRPLLDS
  VAQQQGAWLPHVADFRWRVDVAISTSALARSLQPSVLMQLKLSDGSAYRFEVPTAKFQELRYSVALVLKE
  MADLEKRCERRLQD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001074473
• RefSeq Size: 1321
• RefSeq ORF: 672
• Synonyms: HCARG; HT002
• Locus ID: 28991
• UniProt ID: Q9GZQ3
• Cytogenetics: 8q24.3
• Protein Families: Druggable Genome