COMMD5 (NM_001081004) Human Recombinant Protein

CAT#: TP301051

Recombinant protein of human COMM domain containing 5 (COMMD5), transcript variant 3

Product Images

Coomassie blue staining of purified COMMD5 protein (Cat# TP301051). The protein was produced from HEK293T cells transfected with COMMD5 cDNA clone (Cat# RC201051) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201051 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSAVGAATPYLHHPGDSHSGRVSFLGAQLPPEVAAMARLLGDLDRSTFRKLLKFVVSSLQGEDCREAVQR
  LGVSANLPEEQLGALLAGMHTLLQQALRLPPTSLKPDTFRDQLQELCIPQDLVGDLASVVFGSQRPLLDS
  VAQQQGAWLPHVADFRWRVDVAISTSALARSLQPSVLMQLKLSDGSAYRFEVPTAKFQELRYSVALVLKE
  MADLEKRCERRLQD
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 24.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001074473
• Locus ID: 28991
• UniProt ID: Q9GZQ3
• Cytogenetics: 8q24.3
• Refseq Size: 1321
• Refseq ORF: 672
• Synonyms: HCARG; HT002
• Summary: May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes (PubMed:21778237). Negatively regulates cell proliferation. Negatively regulates cell cycle G2/M phase transition probably by transactivating p21/CDKN1A through the p53/TP53-independent signaling pathway. Involved in kidney proximal tubule morphogenesis (By similarity). Down-regulates activation of NF-kappa-B (PubMed:15799966).[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome