MYL9 (NM_181526) Human Mass Spec Standard

CAT#: PH301080

MYL9 MS Standard C13 and N15-labeled recombinant protein (NP_852667)

Product Images

Coomassie blue staining of purified MYL9 protein (Cat# TP301080). The protein was produced from HEK293T cells transfected with MYL9 cDNA clone (Cat# RC201080) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201080
• Predicted MW: 13.9 kDa
• Protein Sequence:
  Sequence Link

  >RC201080 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGFIHEDHLR
  ELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_852667
• RefSeq Size: 1054
• RefSeq ORF: 354
• Synonyms: LC20; MLC-2C; MLC2; MRLC1; MYRL2
• Locus ID: 10398
• UniProt ID: P24844
• Cytogenetics: 20q11.23
• Summary: Myosin, a structural component of muscle, consists of two heavy chains and four light chains. The protein encoded by this gene is a myosin light chain that may regulate muscle contraction by modulating the ATPase activity of myosin heads. The encoded protein binds calcium and is activated by myosin light chain kinase. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
• Protein Pathways: Focal adhesion, Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Tight junction, Vascular smooth muscle contraction