ACAA2 (NM_006111) Human Mass Spec Standard

CAT#: PH301096

ACAA2 MS Standard C13 and N15-labeled recombinant protein (NP_006102)

Product Images

Coomassie blue staining of purified ACAA2 protein (Cat# TP301096). The protein was produced from HEK293T cells transfected with ACAA2 cDNA clone (Cat# RC201096) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201096
• Predicted MW: 41.9 kDa
• Protein Sequence:
  Sequence Link

  >RC201096 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MALLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETVDSVIMGNVLQSSSDAIYLA
  RHVGLRVGIPKETPALTINRLCGSGFQSIVNGCQEICVKEAEVVLCGGTESMSQAPYCVRNVRFGTKLGS
  DIKLEDSLWVSLTDQHVQLPMAMTAENLAVKHKISREECDKYALQSQQRWKAANDAGYFNDEMAPIEVKT
  KKGKQTMQVDEHARPQTTLEQLQKLPPVFKKDGTVTAGNASGVADGAGAVIIASEDAVKKHNFTPLARIV
  GYFVSGCDPSIMGIGPVPAISGALKKAGLSLKDMDLVEVNEAFAPQYLAVERSLDLDISKTNVNGGAIAL
  GHPLGGSGSRITAHLVHELRRRGGKYAVGSACIGGGQGIAVIIQSTA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006102
• RefSeq Size: 1952
• RefSeq ORF: 1191
• Synonyms: DSAEC
• Locus ID: 10449
• UniProt ID: P42765, B3KNP8
• Cytogenetics: 18q21.1
• Summary: The encoded protein catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal. [provided by RefSeq, Jul 2008]
• Protein Pathways: Fatty acid elongation in mitochondria, Fatty acid metabolism, Metabolic pathways, Valine, leucine and isoleucine degradation