ACAA2 (NM_006111) Human Recombinant Protein

CAT#: TP301096

Recombinant protein of human acetyl-Coenzyme A acyltransferase 2 (ACAA2), nuclear gene encoding mitochondrial protein


  View other "ACAA2" proteins (3)

USD 823.00

4 Weeks*

Size
    • 20 ug

Product Images

Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 412.00


ACAA2 mouse monoclonal antibody, clone OTI1C10 (formerly 1C10)
    • 100 ul

USD 447.00

Other products for "ACAA2"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC201096 protein sequence
Red=Cloning site Green=Tags(s)

MALLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETVDSVIMGNVLQSSSDAIYLA
RHVGLRVGIPKETPALTINRLCGSGFQSIVNGCQEICVKEAEVVLCGGTESMSQAPYCVRNVRFGTKLGS
DIKLEDSLWVSLTDQHVQLPMAMTAENLAVKHKISREECDKYALQSQQRWKAANDAGYFNDEMAPIEVKT
KKGKQTMQVDEHARPQTTLEQLQKLPPVFKKDGTVTAGNASGVADGAGAVIIASEDAVKKHNFTPLARIV
GYFVSGCDPSIMGIGPVPAISGALKKAGLSLKDMDLVEVNEAFAPQYLAVERSLDLDISKTNVNGGAIAL
GHPLGGSGSRITAHLVHELRRRGGKYAVGSACIGGGQGIAVIIQSTA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 41.7 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_006102
Locus ID 10449
UniProt ID P42765, B3KNP8
Cytogenetics 18q21.1
Refseq Size 1952
Refseq ORF 1191
Synonyms DSAEC
Summary The encoded protein catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal. [provided by RefSeq, Jul 2008]
Protein Pathways Fatty acid elongation in mitochondria, Fatty acid metabolism, Metabolic pathways, Valine, leucine and isoleucine degradation

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.