ACAA2 (NM_006111) Human Recombinant Protein

CAT#: TP301096

Recombinant protein of human acetyl-Coenzyme A acyltransferase 2 (ACAA2), nuclear gene encoding mitochondrial protein

Product Images

Coomassie blue staining of purified ACAA2 protein (Cat# TP301096). The protein was produced from HEK293T cells transfected with ACAA2 cDNA clone (Cat# RC201096) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201096 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MALLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETVDSVIMGNVLQSSSDAIYLA
  RHVGLRVGIPKETPALTINRLCGSGFQSIVNGCQEICVKEAEVVLCGGTESMSQAPYCVRNVRFGTKLGS
  DIKLEDSLWVSLTDQHVQLPMAMTAENLAVKHKISREECDKYALQSQQRWKAANDAGYFNDEMAPIEVKT
  KKGKQTMQVDEHARPQTTLEQLQKLPPVFKKDGTVTAGNASGVADGAGAVIIASEDAVKKHNFTPLARIV
  GYFVSGCDPSIMGIGPVPAISGALKKAGLSLKDMDLVEVNEAFAPQYLAVERSLDLDISKTNVNGGAIAL
  GHPLGGSGSRITAHLVHELRRRGGKYAVGSACIGGGQGIAVIIQSTA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 41.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006102
• Locus ID: 10449
• UniProt ID: P42765, B3KNP8
• Cytogenetics: 18q21.1
• Refseq Size: 1952
• Refseq ORF: 1191
• Synonyms: DSAEC
• Summary: The encoded protein catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal. [provided by RefSeq, Jul 2008]
• Protein Pathways: Fatty acid elongation in mitochondria, Fatty acid metabolism, Metabolic pathways, Valine, leucine and isoleucine degradation