Cortactin (CTTN) (NM_138565) Human Mass Spec Standard
CAT#: PH301111
CTTN MS Standard C13 and N15-labeled recombinant protein (NP_612632)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201111 |
Predicted MW | 57.5 kDa |
Protein Sequence |
>RC201111 protein sequence
Red=Cloning site Green=Tags(s) MWKASAGHAVSIAQDDAGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRENVFQEHQTLK EKELETGPKASHGYGGKFGVEQDRMDKSAVGHEYQSKLSKHCSQVDSVRGFGGKFGVQMDRVDQSAVGFE YQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQRDYSKGFGGKYGIDKDKVDKSA VGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYSKGFGGKYGVQKDRM DKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEA RRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVYEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREAS SQQGLAYATEAVYESAEAPGHYPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDD GWWRGVCKGRYGLFPANYVELRQ myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_612632 |
RefSeq Size | 3208 |
RefSeq ORF | 1539 |
Synonyms | EMS1 |
Locus ID | 2017 |
UniProt ID | Q14247, Q53HG7, A0A024R5M3 |
Cytogenetics | 11q13.3 |
Summary | 'This gene is overexpressed in breast cancer and squamous cell carcinomas of the head and neck. The encoded protein is localized in the cytoplasm and in areas of the cell-substratum contacts. This gene has two roles: (1) regulating the interactions between components of adherens-type junctions and (2) organizing the cytoskeleton and cell adhesion structures of epithelia and carcinoma cells. During apoptosis, the encoded protein is degraded in a caspase-dependent manner. The aberrant regulation of this gene contributes to tumor cell invasion and metastasis. Three splice variants that encode different isoforms have been identified for this gene. [provided by RefSeq, May 2010]' |
Protein Families | Druggable Genome |
Protein Pathways | Pathogenic Escherichia coli infection, Tight junction |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403359 | CTTN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC417430 | CTTN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC429248 | CTTN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY403359 | Transient overexpression lysate of cortactin (CTTN), transcript variant 2 |
USD 325.00 |
|
LY417430 | Transient overexpression lysate of cortactin (CTTN), transcript variant 1 |
USD 495.00 |
|
LY429248 | Transient overexpression lysate of cortactin (CTTN), transcript variant 1 |
USD 325.00 |
|
TP301111 | Recombinant protein of human cortactin (CTTN), transcript variant 2 |
USD 867.00 |
|
TP710315 | Purified recombinant protein of Human cortactin (CTTN / EMS1), transcript variant 2, full length, with C-terminal DDK tag, expressed in sf9, 20ug |
USD 425.00 |
{0} Product Review(s)
Be the first one to submit a review