Cortactin (CTTN) (NM_138565) Human Recombinant Protein
CAT#: TP301111
Recombinant protein of human cortactin (CTTN), transcript variant 2
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201111 protein sequence
Red=Cloning site Green=Tags(s) MWKASAGHAVSIAQDDAGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRENVFQEHQTLK EKELETGPKASHGYGGKFGVEQDRMDKSAVGHEYQSKLSKHCSQVDSVRGFGGKFGVQMDRVDQSAVGFE YQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQRDYSKGFGGKYGIDKDKVDKSA VGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYSKGFGGKYGVQKDRM DKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEA RRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVYEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREAS SQQGLAYATEAVYESAEAPGHYPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDD GWWRGVCKGRYGLFPANYVELRQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 57.3 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Bioactivity | ELISA capture for autoantibodies (PMID: 27379450) ELISA capture for autoantibodies (PMID: 29068555) |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_612632 |
| Locus ID | 2017 |
| UniProt ID | Q14247, Q53HG7, A0A024R5M3, Q8N707 |
| Cytogenetics | 11q13.3 |
| Refseq Size | 3208 |
| Refseq ORF | 1539 |
| Synonyms | EMS1 |
| Summary | This gene is overexpressed in breast cancer and squamous cell carcinomas of the head and neck. The encoded protein is localized in the cytoplasm and in areas of the cell-substratum contacts. This gene has two roles: (1) regulating the interactions between components of adherens-type junctions and (2) organizing the cytoskeleton and cell adhesion structures of epithelia and carcinoma cells. During apoptosis, the encoded protein is degraded in a caspase-dependent manner. The aberrant regulation of this gene contributes to tumor cell invasion and metastasis. Three splice variants that encode different isoforms have been identified for this gene. [provided by RefSeq, May 2010] |
| Protein Families | Druggable Genome |
| Protein Pathways | Pathogenic Escherichia coli infection, Tight junction |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403359 | CTTN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC417430 | CTTN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC429248 | CTTN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY403359 | Transient overexpression lysate of cortactin (CTTN), transcript variant 2 |
USD 436.00 |
|
| LY417430 | Transient overexpression lysate of cortactin (CTTN), transcript variant 1 |
USD 665.00 |
|
| LY429248 | Transient overexpression lysate of cortactin (CTTN), transcript variant 1 |
USD 396.00 |
|
| PH301111 | CTTN MS Standard C13 and N15-labeled recombinant protein (NP_612632) |
USD 2,055.00 |
|
| TP710315 | Purified recombinant protein of Human cortactin (CTTN / EMS1), transcript variant 2, full length, with C-terminal DDK tag, expressed in sf9, 20ug |
USD 425.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China