POLR2D (NM_004805) Human Mass Spec Standard

CAT#: PH301116

POLR2D MS Standard C13 and N15-labeled recombinant protein (NP_004796)

Product Images

Coomassie blue staining of purified POLR2D protein (Cat# TP301116). The protein was produced from HEK293T cells transfected with POLR2D cDNA clone (Cat# RC201116) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201116
• Predicted MW: 16.3 kDa
• Protein Sequence:
  Sequence Link

  >RC201116 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTAR
  FSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSF
  QY
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004796
• RefSeq Size: 2338
• RefSeq ORF: 426
• Synonyms: HSRBP4; HSRPB4; RBP4; RPB16
• Locus ID: 5433
• UniProt ID: O15514
• Cytogenetics: 2q14.3
• Summary: 'This gene encodes the fourth largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. In yeast, this polymerase subunit is associated with the polymerase under suboptimal growth conditions and may have a stress protective role. A sequence for a ribosomal pseudogene is contained within the 3' untranslated region of the transcript from this gene. [provided by RefSeq, Jul 2008]'
• Protein Families: Transcription Factors
• Protein Pathways: Huntington's disease, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase