POLR2D (NM_004805) Human Recombinant Protein
CAT#: TP301116
Recombinant protein of human polymerase (RNA) II (DNA directed) polypeptide D (POLR2D)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201116 protein sequence
Red=Cloning site Green=Tags(s) MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTAR FSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSF QY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.1 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004796 |
Locus ID | 5433 |
UniProt ID | O15514 |
Cytogenetics | 2q14.3 |
Refseq Size | 2338 |
Refseq ORF | 426 |
Synonyms | HSRBP4; HSRPB4; RBP4; RPB4; RPB16 |
Summary | This gene encodes the fourth largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. In yeast, this polymerase subunit is associated with the polymerase under suboptimal growth conditions and may have a stress protective role. A sequence for a ribosomal pseudogene is contained within the 3' untranslated region of the transcript from this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Protein Pathways | Huntington's disease, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417740 | POLR2D HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY417740 | Transient overexpression lysate of polymerase (RNA) II (DNA directed) polypeptide D (POLR2D) |
USD 396.00 |
|
PH301116 | POLR2D MS Standard C13 and N15-labeled recombinant protein (NP_004796) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review