ASCL1 (NM_004316) Human Mass Spec Standard
CAT#: PH301123
ASCL1 MS Standard C13 and N15-labeled recombinant protein (NP_004307)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201123 |
Predicted MW | 25.5 kDa |
Protein Sequence |
>RC201123 protein sequence
Red=Cloning site Green=Tags(s) MESSAKMESGGAGQQPQPQPQQPFLPPAACFFATAAAAAAAAAAAAAQSAQQQQQQQQQQQQAPQLRPAA DGQPSGGGHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYSLPQQQPAAVARRNERERNRVKLVNLGFAT LREHVPNGAANKKMSKVETLRSAVEYIRALQQLLDEHDAVSAAFQAGVLSPTISPNYSNDLNSMAGSPVS SYSSDEGSYDPLSPEEQELLDFTNWF myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_004307 |
RefSeq Size | 2490 |
RefSeq ORF | 708 |
Synonyms | ASH1; bHLHa46; HASH1; MASH1 |
Locus ID | 429 |
UniProt ID | P50553 |
Cytogenetics | 12q23.2 |
Summary | 'This gene encodes a member of the basic helix-loop-helix (BHLH) family of transcription factors. The protein activates transcription by binding to the E box (5'-CANNTG-3'). Dimerization with other BHLH proteins is required for efficient DNA binding. This protein plays a role in the neuronal commitment and differentiation and in the generation of olfactory and autonomic neurons. Mutations in this gene may contribute to the congenital central hypoventilation syndrome (CCHS) phenotype in rare cases. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401374 | ASCL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401374 | Transient overexpression lysate of achaete-scute complex homolog 1 (Drosophila) (ASCL1) |
USD 396.00 |
|
TP301123 | Recombinant protein of human achaete-scute complex homolog 1 (Drosophila) (ASCL1) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review